PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026746m
Common NameCARUB_v10026746mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 337aa    MW: 38250 Da    PI: 7.3558
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026746mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-33187244259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+
  Carubv10026746m 187 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHP 244
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381309.0E-1051336IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.803.4E-34171246IPR003657WRKY domain
SuperFamilySSF1182906.02E-29178246IPR003657WRKY domain
PROSITE profilePS5081132.282181246IPR003657WRKY domain
SMARTSM007746.1E-38186245IPR003657WRKY domain
PfamPF031062.2E-25187244IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051607Biological Processdefense response to virus
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:1901002Biological Processpositive regulation of response to salt stress
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSNEIKDLNN YHYTSSYNHY NNINNQNMMN LSYVSGPSSY NANMIVSSSQ LGFDLPSKNL  60
SPQGAFDLGF ELSPSSSEFF NPSIDQDNGL YNAFNYNSCH KSQEVVGGGG CATTIKSEVR  120
VSPSPSSSEA DHHPGDDSGK IMKKREAGDG GEDDQPSQKV VKTKKKEEKK KEPRVSFMTK  180
TEVDHLEDGY RWRKYGQKAV KNSPYPRSYY RCTTQKCNVK KRVERSYQDP TVVITTYESQ  240
HNHPIPTNRR TAMFSGTTAT DYNPSSTPIF SDLIINTPRS FSNDDLFRVP YASVNVNPNY  300
HQQQQQQQQQ GFHQQESDQF ELLKEMFPSV FFKQEH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-28176246777Probable WRKY transcription factor 4
1wj2_A3e-28176246777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00545DAPTransfer from AT5G46350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4048550.0AF404855.1 Arabidopsis thaliana WRKY transcription factor 8 (WRKY8) mRNA, complete cds.
GenBankAY0639160.0AY063916.1 Arabidopsis thaliana unknown protein (At5g46350) mRNA, complete cds.
GenBankAY0964260.0AY096426.1 Arabidopsis thaliana unknown protein (At5g46350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280775.10.0hypothetical protein CARUB_v10026746mg
SwissprotQ9FL260.0WRKY8_ARATH; Probable WRKY transcription factor 8
TrEMBLR0GR660.0R0GR66_9BRAS; Uncharacterized protein
STRINGAT5G46350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46350.11e-165WRKY DNA-binding protein 8